KEGG   Dehalobacter sp. CF: DCF50_p2063
Entry
DCF50_p2063       CDS       T02279                                 
Name
(GenBank) Aspartokinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
dec  Dehalobacter sp. CF
Pathway
dec00260  Glycine, serine and threonine metabolism
dec00261  Monobactam biosynthesis
dec00270  Cysteine and methionine metabolism
dec00300  Lysine biosynthesis
dec01100  Metabolic pathways
dec01110  Biosynthesis of secondary metabolites
dec01120  Microbial metabolism in diverse environments
dec01210  2-Oxocarboxylic acid metabolism
dec01230  Biosynthesis of amino acids
Module
dec_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
dec_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:dec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DCF50_p2063
   00270 Cysteine and methionine metabolism
    DCF50_p2063
   00300 Lysine biosynthesis
    DCF50_p2063
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    DCF50_p2063
Enzymes [BR:dec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     DCF50_p2063
SSDB
Motif
Pfam: AA_kinase ACT_7 ACT_9 ACT LamB_YcsF
Other DBs
NCBI-ProteinID: AFV06066
LinkDB
Position
complement(2118701..2119948)
AA seq 415 aa
MEEGEITLRILVQKFGGTSLANPERRAQVAAKVSEAINQGFSPVVVVSAIGRSGDPYATD
TLIKMVSSIYSEVPKREMDLLLSCGEIISGSIMVSTLQGLGLEAVLLTGGQAGIITNSSF
GDARIVRIEPENILEQLKEGKVVVITGFQGMTENGQITTLGRGGSDTTACSIGVALNAEA
IDIYTDVEGIMTADPRIVQDAKILDVITYNDICHLAHQGAKVIHPRAVEIAMQKNIPLRV
KCTFSDAPGTLVTNVQPDLAEGSDMIGDRIITGIAHTPNVTQIKIHIQEEENKPKAITKI
FKGMALADISVDFISVQPETVLYTVRDELAKKAVNILKNLGFNPESAPGCAKIALVGGGI
ADVPGVMANMAEALAESGIEILQSADSHTTIWVLVRKEHMVPAVQSLHKKFELGI
NT seq 1248 nt   +upstreamnt  +downstreamnt
ttggaggaaggagaaattaccttgcgtatattggttcaaaaatttggcggaacttccctg
gccaatccggaaagaagagcgcaggtcgctgctaaggtttccgaggctattaatcaaggg
ttttcgcctgtggttgttgtttctgcaatcgggcgttcgggagatccctatgcgaccgat
acgctgattaagatggtttcaagcatttattccgaagtgcccaaaagagaaatggattta
ctcttaagttgcggggaaatcatttccggcagcattatggttagcacgctgcagggtctc
gggttggaagctgttcttttaacgggtggacaggccggcattatcaccaacagcagtttt
ggcgatgcaagaattgtcagaatcgaaccggaaaatatcctggagcagctgaaagaaggc
aaggttgtcgtcattacgggcttccagggcatgaccgaaaacggacaaattacaaccctg
ggcagaggcggaagcgatacgacggcctgttcgattggcgtcgcactaaatgctgaagca
atcgatatttatacggacgtcgaaggtattatgaccgcagacccccggatcgtccaggat
gccaaaattcttgacgtgatcacctataatgatatctgccatctggcgcatcagggagct
aaagtcatccatccgcgtgccgtggaaatcgcgatgcaaaagaatatcccactacgggta
aaatgtacgttttccgatgctcctggaacgctggtcaccaatgttcagcccgaccttgcg
gagggctcggacatgatcggcgacaggattattacagggattgcacataccccgaatgtc
acccagatcaagatccacattcaagaagaagaaaataaacccaaagcgatcaccaaaata
ttcaaagggatggctttagccgatattagtgtcgatttcatcagcgttcagccagaaact
gtcctgtatacagttcgtgatgagctggcaaagaaagccgtcaatattttaaagaatctg
ggctttaaccctgaatccgcaccaggatgcgccaagattgcgcttgtcggcgggggaatt
gccgatgtacccggtgtcatggccaatatggcagaagcacttgctgagagcggcattgag
attcttcagtccgctgactcccataccacgatctgggtgcttgtcagaaaggaacatatg
gttccggctgttcagtctttgcacaaaaagtttgagcttggtatttga

DBGET integrated database retrieval system