KEGG   Dehalobacter sp. CF: DCF50_p2332
Entry
DCF50_p2332       CDS       T02279                                 
Symbol
cheY
Name
(GenBank) Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
dec  Dehalobacter sp. CF
Pathway
dec02020  Two-component system
dec02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DCF50_p2332 (cheY)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    DCF50_p2332 (cheY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dec02022]
    DCF50_p2332 (cheY)
   02035 Bacterial motility proteins [BR:dec02035]
    DCF50_p2332 (cheY)
Two-component system [BR:dec02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   DCF50_p2332 (cheY)
Bacterial motility proteins [BR:dec02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DCF50_p2332 (cheY)
SSDB
Motif
Pfam: Response_reg CoA_binding_2
Other DBs
NCBI-ProteinID: AFV06335
LinkDB
Position
complement(2405035..2405400)
AA seq 121 aa
MIRVLIVDDAAFMRLAIRNMLQNNGFEVVGEAANGLEGLESYKQLQPDVVTMDITMPEMS
GLEALPEIMKFDPKAKVVMVSAMGQESMVRQAVALGAKSFIIKPFKEDVVVKTLNQVNAL
K
NT seq 366 nt   +upstreamnt  +downstreamnt
ttgattagagtactgattgtagatgatgcggcatttatgcggctggcgatcagaaatatg
cttcagaacaacggttttgaggtcgtcggtgaggctgcgaacgggttggaaggcctggaa
agctataaacaattgcaacctgatgtcgttaccatggatattacgatgcctgaaatgtcc
ggtttggaagcattacctgaaatcatgaaatttgatccgaaagccaaggtcgtgatggtt
tccgcgatgggacaggaaagtatggtaaggcaggctgttgcgcttggtgcaaagtccttt
attatcaaaccgttcaaagaggatgtcgtagtcaaaaccttaaatcaggtgaatgcatta
aaatag

DBGET integrated database retrieval system