Dehalobacter sp. CF: DCF50_p2724 Help Entry DCF50_p2724       CDS       T02279                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dec  Dehalobacter sp. CF Pathway dec01100   Metabolic pathways dec01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dec00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DCF50_p2724    00074 Mycolic acid biosynthesis     DCF50_p2724   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DCF50_p2724 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AFV06727 LinkDB All DBs Position complement(2808239..2808469) Genome browser AA seq 76 aa AA seqDB search MSFDTICRIIASQFETEPEKIQLSTKFQQDLGIDSLSIFEIVMELEDVYRIEIPTEDLEE LISVADLVDYINKRTN NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtcttttgacacgatctgcaggattatcgcttcccagtttgagactgaaccggagaaa attcagttgtccaccaagttccagcaagacctcggaattgactctctaagcatttttgaa attgtcatggagctggaagatgtatacaggattgaaattccgactgaagatcttgaagaa ttaatcagcgtagcagatctggttgactatataaataagcgaacaaattga

DBGET integrated database retrieval system