Dehalobacter sp. CF: DCF50_p330 Help Entry DCF50_p330        CDS       T02279                                  Name (GenBank) DNA-binding protein HBsu   KO K03530   DNA-binding protein HU-beta Organism dec  Dehalobacter sp. CF Brite KEGG Orthology (KO) [BR:dec00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dec03032]     DCF50_p330    03036 Chromosome and associated proteins [BR:dec03036]     DCF50_p330    03400 DNA repair and recombination proteins [BR:dec03400]     DCF50_p330 DNA replication proteins [BR:dec03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DCF50_p330 Chromosome and associated proteins [BR:dec03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DCF50_p330 DNA repair and recombination proteins [BR:dec03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DCF50_p330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 DUF2267 HU-CCDC81_euk_1 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AFV04336 UniProt:  K4L183 LinkDB All DBs Position 342660..342932 Genome browser AA seq 90 aa AA seqDB search MNKAELVAAVAEKTEFTKKDAEKAVAAVFDTISQAMASGEKVQLVGFGTFEVKKREERVG RNPQTKEEIVIPACKVPGFKAGKALKESVQ NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ttgaataaagcggaactcgttgctgcagtagcagaaaagaccgaattcaccaagaaggat gccgaaaaagcggtagccgcagtctttgacacaatcagtcaagcaatggcaagtggtgag aaagtccaattagttggttttggtacatttgaggttaagaaaagagaagagcgtgtcggt agaaatcctcaaaccaaagaggaaattgtcattcccgcatgcaaagtacctggctttaag gcaggaaaagctttaaaagagtcagtacagtaa

DBGET integrated database retrieval system