Dechloromonas sp. TW-R-39-2: GBK02_08680 Help Entry GBK02_08680       CDS       T08942                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism dech  Dechloromonas sp. TW-R-39-2 Brite KEGG Orthology (KO) [BR:dech00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dech03032]     GBK02_08680    03036 Chromosome and associated proteins [BR:dech03036]     GBK02_08680    03400 DNA repair and recombination proteins [BR:dech03400]     GBK02_08680 DNA replication proteins [BR:dech03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GBK02_08680 Chromosome and associated proteins [BR:dech03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GBK02_08680 DNA repair and recombination proteins [BR:dech03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GBK02_08680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 FIMAH Motif Other DBs NCBI-ProteinID:  QRM19468 UniProt:  A0A974SVZ5 LinkDB All DBs Position complement(1844199..1844471) Genome browser AA seq 90 aa AA seqDB search MNKTELIDQIAASADISKAAAGRALDATVEAVKAALKAGDTVSLIGFGTFYVGERAARTG RNPRTGKTLEIKAAKSPKFRAGKGLKDAIN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagactgaactgatcgatcaaatcgctgcatccgctgacatttccaaggctgct gccggccgcgcgctcgacgctaccgtcgaagccgtcaaggctgccctgaaggccggcgac accgtcagcctgattggcttcggtacgttctacgtcggcgaacgcgccgcccgcaccggt cgcaacccgcgcaccggcaagacccttgaaatcaaggccgccaagtcgccgaaattccgc gctggcaagggtctgaaagacgccatcaactaa

DBGET integrated database retrieval system