KEGG   Dechloromonas sp. TW-R-39-2: GBK02_10160
Entry
GBK02_10160       CDS       T08942                                 
Name
(GenBank) ribonuclease III
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
dech  Dechloromonas sp. TW-R-39-2
Pathway
dech03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:dech00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    GBK02_10160
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dech03019]
    GBK02_10160
   03009 Ribosome biogenesis [BR:dech03009]
    GBK02_10160
   03036 Chromosome and associated proteins [BR:dech03036]
    GBK02_10160
Enzymes [BR:dech01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     GBK02_10160
Messenger RNA biogenesis [BR:dech03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     GBK02_10160
Ribosome biogenesis [BR:dech03009]
 Eukaryotic type
  90S particles
   RNase
    GBK02_10160
 Prokaryotic type
  rRNA processing factors
   GBK02_10160
Chromosome and associated proteins [BR:dech03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     GBK02_10160
SSDB
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm RM44_endonuclase DND1_DSRM DSRM_2
Other DBs
NCBI-ProteinID: QRM19742
LinkDB
Position
2122162..2122830
AA seq 222 aa
MSAVALAQAIGHRFADPSLLKTALTHRSFGSPNNERLEFLGDGLLNCVVAAALYRRFPAM
PEGDLSRQRANLVRQDALHGLALKLKVGEYLRLGEGELKSGGAQRPSILADALEALFGAI
YLDAGFEAVDAVINRLYQPLFEALTPGEVKKDAKTCLQEWLQGRKKALPKYHLLEATGAA
HEQRFEVACEIENPPLRTIGHGTSRRIAEQVAADNALKVLKA
NT seq 669 nt   +upstreamnt  +downstreamnt
atgagcgccgttgcattggcccaggccatcggtcaccgatttgccgacccgagcttgctc
aagacggcactgacgcatcgtagtttcggctcgccgaataacgagcgacttgagtttctc
ggtgatggcttgctgaattgcgtggttgccgccgccttatacaggcgttttcctgcgatg
ccggaaggcgatttgtcacgtcagcgagccaatcttgtccggcaagatgcgctgcatggc
ctggccctcaagctcaaggtcggcgaatatcttcgtctgggcgagggggagctcaaaagc
ggtggcgcccaacgtccatcgattctggccgatgctctggaagccctgttcggtgcgatt
tatctcgatgccggtttcgaagcggtcgatgcggtgatcaatcgcctctatcagcccctg
ttcgaggcgctgacgcccggcgaggtcaagaaggacgccaagacctgtctgcaggaatgg
cttcaggggcgcaagaaagctcttcccaaatatcacttgcttgaagcgacgggcgctgcg
cacgaacagcgtttcgaagttgcctgcgaaatcgaaaatccgcccttgcgtacgatcggt
cacggcaccagtcgccgtatcgctgagcaagttgccgctgacaacgcactgaaagtactc
aaggcatga

DBGET integrated database retrieval system