Dechloromonas sp. TW-R-39-2: GBK02_10455 Help Entry GBK02_10455       CDS       T08942                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dech  Dechloromonas sp. TW-R-39-2 Pathway dech01100   Metabolic pathways dech01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dech00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GBK02_10455    00074 Mycolic acid biosynthesis     GBK02_10455   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GBK02_10455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QRM19792 LinkDB All DBs Position complement(2175468..2175737) Genome browser AA seq 89 aa AA seqDB search MNAALCLELKELIVEACDKDCDPASIGDDELLFGPEAALQLDSLDALQVSMAIKKKYGLR LPDSKETRRILSSVGNMAEHLDAWLASRA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaacgctgccctctgtcttgaactcaaggaactgatcgtcgaagcctgcgacaaggat tgcgatccggccagcatcggtgacgacgaactgctgttcgggccggaagccgcgctgcag ctcgattcgctcgatgccctgcaggtttcgatggcgatcaagaaaaaatacggcctgcgc ctgccggacagcaaggaaacgcggcgcattctgtcgagcgtcggcaacatggccgagcac ctcgacgcctggctcgccagccgggcatga

DBGET integrated database retrieval system