Desulfovibrio sp. G11: CNY67_04865 Help Entry CNY67_04865       CDS       T05183                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism def  Desulfovibrio sp. G11 Pathway def01100   Metabolic pathways def01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:def00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CNY67_04865    00074 Mycolic acid biosynthesis     CNY67_04865   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CNY67_04865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  ATD80813 UniProt:  A0A807ZH15 LinkDB All DBs Position complement(1071716..1071949) Genome browser AA seq 77 aa AA seqDB search MSDVAEKVKKIIVDQLGVSADEVKPEASFVEDLGADSLDLTELIMAMEEEFEVEIADEDA QKILKVQDAIAYIEEKK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtctgatgtcgccgaaaaagttaaaaaaattattgtagaccagctgggcgtcagcgct gatgaagtcaaacccgaagccagcttcgtggaagacctgggcgccgactccctggacctg actgaactgatcatggccatggaagaagagttcgaagtcgaaatcgccgacgaggacgct cagaagatcctgaaagttcaggacgccattgcctatatcgaagaaaagaaatag

DBGET integrated database retrieval system