Dehalobacter sp. CP: AAH944_07120 Help Entry AAH944_07120      CDS       T11158                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism deha  Dehalobacter sp. CP Pathway deha02024   Quorum sensing deha03018   RNA degradation Brite KEGG Orthology (KO) [BR:deha00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AAH944_07120 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AAH944_07120 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:deha03019]     AAH944_07120 (hfq)    03036 Chromosome and associated proteins [BR:deha03036]     AAH944_07120 (hfq) Messenger RNA biogenesis [BR:deha03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AAH944_07120 (hfq) Chromosome and associated proteins [BR:deha03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AAH944_07120 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  XOF54995 LinkDB All DBs Position 1405368..1405613 Genome browser AA seq 81 aa AA seqDB search MNKSPINLQDVFLNQIRKDNIPVTIYLVNGFQLKGLVKGFDNFTVVLDYEGKQQMVYKHA ISTIMPMRQVNLNALVGEMTE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaataaatcaccgattaacttgcaggatgttttcttgaaccaaatccgcaaagataac atacctgttacgatctatttggtcaatggattccagcttaaaggattagtcaaaggtttt gataattttacggttgttctggactacgaaggcaaacaacaaatggtatataaacatgcc atttctaccataatgccaatgagacaagtcaatttaaatgccttagtcggggaaatgact gagtaa

DBGET integrated database retrieval system