Devosia sp. I507: C4375_15250
Help
Entry
C4375_15250 CDS
T05346
Name
(GenBank) hypothetical protein
KO
K02397
flagellar hook-associated protein 3 FlgL
Organism
dei
Devosia sp. I507
Pathway
dei02040
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:
dei00001
]
09140 Cellular Processes
09142 Cell motility
02040 Flagellar assembly
C4375_15250
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02035 Bacterial motility proteins [BR:
dei02035
]
C4375_15250
Bacterial motility proteins [BR:
dei02035
]
Flagellar system
Flagellar assembly proteins
Rod and hook
C4375_15250
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-ProteinID:
AVF04921
LinkDB
All DBs
Position
3135762..3137744
Genome browser
AA seq
660 aa
AA seq
DB search
MIVNKSMYPLTTGFSIISKMQDKFAQLQMQLGTGVKAQTLSEMGRDLPVSLSVRSRLTTM
AGYNASIEQVDLRMSFYDNALTRLDEIEGEARNSAVQGQYGSNNINMATISGLSKARLDE
MVTLLNSDIAGRYLFGGSTTDKAPLPTTTELLDGAGGRAGYKTVVTERQMADLGSAGLGR
LETTITPAVPALQTDPVTVSLAEDGDHPFGYKLSTVSAIGANIGIASDFAASPANVDFTF
PGDPGTVEEGDSVTLGFTLPDGTETQITLKAVSAANATGATGEFVIGDDPLTATITTATN
FDTALKAALQESAESELKAASTYAAGQNFFNAAGEPVLRVEGADPYTSTSLRVATSTDTV
MWYSGETAAVSAVGMGRLTAARAAETVTLTENVPVSSAHGFQISAVTSAVANAGALTATH
TPGDPASMTVAFDDTFALTAGDSVTVTLTEPGGKTREVTLTAVTGRAGPGQFTIGADEAA
SAENFEKAMIRSVSEAATAAEGNPRQSVTAAVEDSGRVAYGMQANESGYLRMIRSMAAMT
VETYPEITNAADPNSVDLDPAKARFDAMARRQQLELSEGRNSERGSIELITMELGVARAA
LQAAGERHTNYTAQLENLLSDVETVSKEDVAMEILAQQTRLTASYQMTSMVSKLSLVNYL
NT seq
1983 nt
NT seq
+upstream
nt +downstream
nt
atgatcgtcaacaagtccatgtatccgctcacgacgggtttctccatcatctccaagatg
caggacaagttcgcgcagttgcagatgcagcttggtacaggcgtcaaggcgcagacgctt
tcggaaatgggtcgcgacctgccggtgtcgctctcggtgcgctcgcgcctgaccacgatg
gccggctacaatgccagcatcgagcaggtcgatctgcgcatgagcttttacgataatgcg
ctgacgcgcctggacgagatcgagggcgaggcccgcaattcggcggtgcaggggcaatac
ggctcgaacaatatcaacatggcgaccatctcgggcctatccaaggcgcggctggacgaa
atggtgacactgctcaattccgacattgccgggcgctatctgtttggcggctcgacgacc
gacaaggcacccttgccgactacgaccgaactgctcgacggcgcagggggacgggccggc
tacaagaccgtggtcaccgagcgccagatggccgatcttggctcggccgggctggggcgg
ctggaaacgacgatcacccctgccgtgccggccctgcagaccgatccggtgacggtctct
ttggccgaggatggggaccacccattcggctacaagctgtccaccgtgtccgccatcggc
gccaatatcggcattgcttctgactttgcggcttcgcctgccaatgtcgatttcacgttt
ccgggcgacccggggaccgtggaagagggagacagtgtcactctcgggttcaccttgccc
gatggtaccgaaacccagattacgctcaaggctgtcagcgcagccaacgccacaggcgcc
acgggggaatttgtcatcggtgatgatccgttgacggcgaccatcaccacggccaccaat
ttcgacactgctctcaaggccgcgttgcaggagagtgcagagagcgagctgaaggccgca
tcgacctatgcggcgggacagaacttcttcaacgctgccggtgagccggtattgcgggtc
gaaggggccgatccatacacctcgaccagcctgcgcgtggccacctccaccgacacggtg
atgtggtatagcggcgaaaccgctgcggtttccgccgttggcatggggcgcctgactgcg
gcgcgtgctgccgaaaccgtgacgctgaccgagaacgttccggtgtcctcggcgcatggt
ttccagatttcggccgtgacctccgctgttgccaatgccggcgctttgacggcaacccac
acgcccggcgatccggcgtcgatgactgtcgcctttgacgacacgtttgcactgacagca
ggcgacagtgtcaccgtgaccctgaccgagcctggcggcaagacgcgtgaggtgacgctg
acggcagttaccgggcgcgccgggccgggacagttcaccattggcgcggacgaggcggcc
tctgccgagaacttcgaaaaggccatgatccgctcggtgtccgaagcggcgactgcggca
gaaggcaatccgcgccagtcggtcactgcggcagtcgaggattcggggcgggttgcctat
ggcatgcaggccaatgaaagcggctatctgcgcatgatccgctcgatggcggcgatgacg
gtcgagacctatcccgaaatcaccaatgcggcagaccccaattcggttgatctagacccg
gccaaggcgcggttcgacgccatggcgcggcggcagcagcttgagttgtcggaagggcgc
aattcggaacgcggctcgatcgagctgatcaccatggagttgggtgtggcccgcgccgcc
ctgcaggctgccggtgagcggcacaccaattacaccgcgcagttggagaacctgctgagc
gatgtggagacggtcagcaaggaggatgtggccatggagatcctggcgcagcagacccgc
ctcaccgcgagctatcagatgacctcgatggtcagcaagttgagcctggtaaactatctg
tag
DBGET
integrated database retrieval system