Deinococcus sp. AJ005: DAAJ005_05950 Help Entry DAAJ005_05950     CDS       T06226                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dein  Deinococcus sp. AJ005 Pathway dein01100   Metabolic pathways dein01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dein00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DAAJ005_05950 (acpP)    00074 Mycolic acid biosynthesis     DAAJ005_05950 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DAAJ005_05950 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QFP76045 UniProt:  A0A5J6YV83 LinkDB All DBs Position 846828..847058 Genome browser AA seq 76 aa AA seqDB search MATFDDVKDVIVDKLGVDADKINPEARFVEDLGADSLETVELIMGLEDKFGVTISDEDAE NIRTVQAAVDYIESKQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcgacttttgatgacgtgaaagatgtgattgtggacaagctgggtgtggacgcggat aagatcaaccccgaggcccgtttcgtggaggatctgggcgcagacagcctggaaaccgtc gagctgatcatgggcctggaagacaagttcggcgtgaccatcagcgatgaggatgccgag aacatccgcaccgtgcaggccgccgtcgattacatcgagagcaagcagtaa

DBGET integrated database retrieval system