Desulfoluna limicola: DSLASN_14460 Help Entry DSLASN_14460      CDS       T07859                                  Symbol hup Name (GenBank) transcriptional regulator   KO K03530   DNA-binding protein HU-beta Organism dek  Desulfoluna limicola Brite KEGG Orthology (KO) [BR:dek00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dek03032]     DSLASN_14460 (hup)    03036 Chromosome and associated proteins [BR:dek03036]     DSLASN_14460 (hup)    03400 DNA repair and recombination proteins [BR:dek03400]     DSLASN_14460 (hup) DNA replication proteins [BR:dek03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DSLASN_14460 (hup) Chromosome and associated proteins [BR:dek03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DSLASN_14460 (hup) DNA repair and recombination proteins [BR:dek03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DSLASN_14460 (hup) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Umbravirus_LDM DUF679 Motif Other DBs NCBI-ProteinID:  BCS95814 UniProt:  A0ABM7PF62 LinkDB All DBs Position 1748957..1749226 Genome browser AA seq 89 aa AA seqDB search MNKGDLVNEVAKVVSSKKEAQAAVDCVLSTITDALTGDDTVTLVGFGTFKAVERKARKGR NPQTGQEISIDARKVPKFVPGKALKDALK NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaggtgatctcgtcaacgaagttgcaaaagttgtcagctctaaaaaagaagct caggctgccgtagattgtgttctctccaccatcaccgatgccctcaccggtgacgatacc gttaccctcgttggtttcggtactttcaaggccgttgaaagaaaagcccgcaaaggcaga aacccccagaccggtcaggaaatcagcatcgacgcacgcaaggttcccaaattcgtacct ggcaaggctctgaaagacgctttgaagtag

DBGET integrated database retrieval system