KEGG   Delftia sp. Cs1-4: DelCs14_4837
Entry
DelCs14_4837      CDS       T01497                                 
Name
(GenBank) Phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
del  Delftia sp. Cs1-4
Pathway
del00770  Pantothenate and CoA biosynthesis
del01100  Metabolic pathways
del01240  Biosynthesis of cofactors
Module
del_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:del00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    DelCs14_4837
Enzymes [BR:del01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     DelCs14_4837
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AEF91809
LinkDB
Position
complement(5443637..5444137)
AA seq 166 aa
MSHDVIAVYPGTFDPITLGHEDVVRRATQLFSHVIVAVAAGHHKKTMFNLEERMQMVREA
VSIYPHVQVESFHGLLRDFVVERGGKAMVRGLRAVTDFDYEFQLAGMNRTLMPEVETVFL
TPSDRYQFISSTFVREIATLDGEIDKFVSPSVRTRLLQKVQANRGS
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagccacgacgtgattgccgtctatcccggaactttcgatccgatcacgctgggtcat
gaagacgtggtgcgccgcgcgacccagctgttcagccacgtcatcgtcgccgtggcggcg
ggccaccacaagaagaccatgttcaatcttgaggagcgcatgcagatggtgcgcgaggcc
gtgtccatctatccccatgtccaggtcgagagctttcatggcctgctgcgcgacttcgtg
gtggagcgcggcggcaaggccatggtgcgcggcctgcgtgcggtcaccgacttcgactac
gagttccagctcgccggcatgaaccgcacgctgatgcccgaggtggagaccgtcttcctc
acgcccagcgaccgctaccagttcatcagcagcaccttcgtgcgcgagatcgccacgctg
gatggcgagatcgacaagttcgtctctcccagcgtgcgtacccgccttctgcagaaggtg
caggccaatcgtgggtcgtga

DBGET integrated database retrieval system