Desulfovibrio sp. 86: DESU86_2921 Help Entry DESU86_2921       CDS       T11413                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism delf  Desulfovibrio sp. 86 Brite KEGG Orthology (KO) [BR:delf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:delf03110]     DESU86_2921 (groS)    03029 Mitochondrial biogenesis [BR:delf03029]     DESU86_2921 (groS) Chaperones and folding catalysts [BR:delf03110]  Heat shock proteins   HSP10    DESU86_2921 (groS) Mitochondrial biogenesis [BR:delf03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     DESU86_2921 (groS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  VZH35034 LinkDB All DBs Position DESU86:complement(3015831..3016118) Genome browser AA seq 95 aa AA seqDB search MKLKPLNDRVLVKRLESEEKTAGGLFIPDTAKEKPSKGQVVAVGPGKVGDNGERTPLAVK AGDEVLFNKYAGTEVKLDGVDHLVMREEDILAIID NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaagctgaaaccccttaacgaccgtgttctggtcaaacgccttgagtccgaagaaaag accgccggtggcctgttcatccccgacacggctaaagaaaagccgtccaagggtcaggtt gtggctgtgggtcccggcaaggtaggggataatggcgagcgcacccctctggccgtcaag gccggggacgaagtgctgttcaacaagtacgccggtactgaagtgaagcttgacggcgtt gaccatctggtcatgcgcgaagaagacattctcgccatcatcgactaa

DBGET integrated database retrieval system