Desulfovibrio sp. 86: DESU86_3129 Help Entry DESU86_3129       CDS       T11413                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism delf  Desulfovibrio sp. 86 Brite KEGG Orthology (KO) [BR:delf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:delf03032]     DESU86_3129 (hup)    03036 Chromosome and associated proteins [BR:delf03036]     DESU86_3129 (hup)    03400 DNA repair and recombination proteins [BR:delf03400]     DESU86_3129 (hup) DNA replication proteins [BR:delf03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DESU86_3129 (hup) Chromosome and associated proteins [BR:delf03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DESU86_3129 (hup) DNA repair and recombination proteins [BR:delf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DESU86_3129 (hup) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 HU-CCDC81_bac_1 Urease_beta Motif Other DBs NCBI-ProteinID:  VZH35242 LinkDB All DBs Position DESU86:complement(3229049..3229321) Genome browser AA seq 90 aa AA seqDB search MSKSDLIKKLKEEAGLATLAQAEAAYEKLFASIAETLKSGNAVTIPGFGSFKTTKRAARK GRNPRTGAEIQIPASTVVKFTPGKALKESL NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagcaaatcagacctgatcaaaaaactgaaagaagaagccgggcttgccacactggcc caagccgaagcagcgtatgaaaagttatttgccagcattgccgagacattgaagagtggc aatgccgttaccattccgggctttggcagcttcaaaaccacaaagcgcgctgcccgcaaa ggccgcaaccctcggacaggcgctgaaattcaaatccctgcgtcaacggtggtgaagttc acccccggcaaggcactgaaggaaagtctgtag

DBGET integrated database retrieval system