Denitratisoma sp. DHT3: B9N43_06320 Help Entry B9N43_06320       CDS       T10559                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism deni  Denitratisoma sp. DHT3 Brite KEGG Orthology (KO) [BR:deni00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:deni03032]     B9N43_06320    03036 Chromosome and associated proteins [BR:deni03036]     B9N43_06320    03400 DNA repair and recombination proteins [BR:deni03400]     B9N43_06320 DNA replication proteins [BR:deni03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     B9N43_06320 Chromosome and associated proteins [BR:deni03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     B9N43_06320 DNA repair and recombination proteins [BR:deni03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       B9N43_06320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  QDX80891 UniProt:  A0A518U8A9 LinkDB All DBs Position complement(1390232..1390522) Genome browser AA seq 96 aa AA seqDB search MNKSELIEALATKAELSKAAAGRAVDVLVEEIVTAVAKGDSVALVGFGTFKSAARAAREG KNPKTGEKIKIAATTVPKFSAGATFKQKVAAKAKKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacaaatccgagctgatcgaagcattggcaacaaaggctgagctttccaaggcggcc gccggtcgtgccgtcgatgttctggtcgaagaaattgtgactgctgttgccaagggggat tcggtggcattggtaggctttggtacattcaagtcggctgcgcgcgcagctcgcgagggc aagaacccgaaaaccggcgagaaaatcaagatcgctgcaacgacggtgccgaagttctct gcgggcgccaccttcaaacagaaagtcgccgccaaagccaaaaagaagtaa

DBGET integrated database retrieval system