Denitratisoma sp. DHT3: B9N43_07930 Help Entry B9N43_07930       CDS       T10559                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism deni  Denitratisoma sp. DHT3 Pathway deni02024   Quorum sensing deni03018   RNA degradation Brite KEGG Orthology (KO) [BR:deni00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     B9N43_07930  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     B9N43_07930  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:deni03019]     B9N43_07930    03036 Chromosome and associated proteins [BR:deni03036]     B9N43_07930 Messenger RNA biogenesis [BR:deni03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      B9N43_07930 Chromosome and associated proteins [BR:deni03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     B9N43_07930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QDX81174 LinkDB All DBs Position complement(1722654..1722887) Genome browser AA seq 77 aa AA seqDB search MSNKGQMLQDPFLNTLRREHIPVSIYLVNGIKLQGQVESFDQYVVLLKNTVTQMVYKHAI STVVPARPVNFSQDAGD NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaataaagggcaaatgttacaagacccgttcctgaatacgctgcgtcgcgagcat attccggtgtccatctaccttgtcaatggcatcaagctgcagggtcaggtcgagtccttc gaccagtacgtggtgctgctcaaaaacaccgtgacccagatggtgtacaagcacgccatt tccaccgtggtgccggcgcgccccgtcaatttcagccaagacgccggcgattga

DBGET integrated database retrieval system