Denitratisoma sp. DHT3: B9N43_15925
Help
Entry
B9N43_15925 CDS
T10559
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
deni Denitratisoma sp. DHT3
Pathway
deni03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
deni00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
B9N43_15925
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
deni03011
]
B9N43_15925
Ribosome [BR:
deni03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
B9N43_15925
Bacteria
B9N43_15925
Archaea
B9N43_15925
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Ribosomal_L5e
Motif
Other DBs
NCBI-ProteinID:
QDX82591
LinkDB
All DBs
Position
3446156..3446509
Genome browser
AA seq
117 aa
AA seq
DB search
MDKKQARLRRARKTRAKIAELRSVRLAVHRSNCHIYAQIFSECGTKVLAAASTAEQGVRG
QVANGGNVEAAKLVGKLIAERALAAGVNQVAFDRSGFHYHGRVKALAEAAREGGLKF
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atggataagaaacaagctcgtttgcgtagggcgcgcaaaacccgcgccaagattgcagag
ctcaggtctgtgcgacttgctgtgcatcgctccaactgtcatatctatgctcagattttt
tctgagtgtggaaccaaggtgctggctgcggcttcgactgccgagcagggcgtgcgtggt
caggttgccaatggcggcaacgtcgaggctgccaaattggtgggcaagttgattgctgag
cgcgctctggcggctggtgtgaatcaagtggcctttgatcggtctggctttcactatcac
ggccgcgttaaggcgttggctgaggctgcccgcgaaggcggcctcaagttctaa
DBGET
integrated database retrieval system