Desulfobulbus oralis: CAY53_00345 Help Entry CAY53_00345       CDS       T05339                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism deo  Desulfobulbus oralis Pathway deo01100   Metabolic pathways deo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:deo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CAY53_00345    00074 Mycolic acid biosynthesis     CAY53_00345   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CAY53_00345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  AVD70122 UniProt:  A0A2L1GKC8 LinkDB All DBs Position complement(100873..101106) Genome browser AA seq 77 aa AA seqDB search MAVEDKMIDIIVEQLSVDREKVVPEASFVNDLGADSLDLVELIMAMEEEFDVEIPDEEAE KIATVQNAIDYVAKLQK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggctgtagaagacaagatgattgacattatcgtggagcagctcagtgttgaccgcgaa aaagtggtgcccgaagcgtcctttgtaaacgatctgggcgctgattccctggatctggtc gaactgatcatggccatggaagaggaattcgatgtggaaattccggacgaagaggccgag aagatcgccactgtgcaaaacgccatcgattatgtggcgaagctgcaaaagtaa

DBGET integrated database retrieval system