KEGG   Desulfobulbus oralis: CAY53_03615
Entry
CAY53_03615       CDS       T05339                                 
Name
(GenBank) branched-chain amino acid ABC transporter permease
  KO
K01997  branched-chain amino acid transport system permease protein
Organism
deo  Desulfobulbus oralis
Pathway
deo02010  ABC transporters
deo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:deo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CAY53_03615
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CAY53_03615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:deo02000]
    CAY53_03615
Transporters [BR:deo02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    CAY53_03615
SSDB
Motif
Pfam: BPD_transp_2
Other DBs
NCBI-ProteinID: AVD72213
UniProt: A0A2L1GR96
LinkDB
Position
834512..835468
AA seq 318 aa
MGSFLQHFADGFAASGGFEQLFQQLTGGLAVGGIYALVALGYTMVYGVLKLINFAHGDLF
TIGAYLGLTLLGSLALGEHLGAFAGIAVLALMVMVLVGLIGIILERSAYRPLRTSPRLSA
VVSALGASIFFQNAVMLIYGPGKFVFPQGLLPATPVQLFGFSVPLMRILILAASLLMMVA
LYLFVQKTRIGTAIRAAAIDQDAARLMGIDVNFVIMIVFFIGPALGGAAGLMVGLYYGQI
GFTMGWIYGLKAFAAAIIGGIGNIPGAMLGGLLLGVIEALGAAYISFAWKDAIAFFVLIL
ILIVRPTGILGERVAEKI
NT seq 957 nt   +upstreamnt  +downstreamnt
atgggatcttttctgcagcactttgccgacggcttcgcggccagcggcggttttgagcag
ctctttcagcaactgaccggcggtctggcggtgggcggcatctatgccctggtggcgctg
ggctataccatggtctacggcgtactgaagctgatcaacttcgcgcacggcgacctcttc
accattggcgcctacctgggcctgaccctgctgggctccctggctctgggcgagcatctg
ggcgccttcgcgggcattgccgtgctggccctcatggtcatggtgctggtcggcctgatc
ggcatcattctggagcgcagcgcctaccggcccctgcgcacctcacccaggctttccgcc
gtggtgtcggccctgggggcctccatctttttccagaatgccgtcatgctcatctacggg
ccgggcaagttcgtgtttccccaggggcttttgcccgcaacgccggtgcagctctttggc
ttttccgtgccgctcatgcgcatcctcatcctggccgcctccctcctgatgatggtggcg
ctctacctgtttgtgcagaagacccgcatcggcacggccatccgggcggcagccatcgat
caggacgcggcccggctcatgggcatcgacgttaacttcgtcatcatgatcgtgttcttc
atcggcccggccctgggcggcgcggcgggattgatggtggggctgtactacggccagatc
ggtttcaccatgggctggatttatggcctcaaggcctttgccgcggccatcatcggcggc
attggcaatatccccggcgccatgctgggggggcttttgctgggggtgattgaggctctg
ggcgcggcctacatttcctttgcctggaaagacgccatcgcctttttcgtgttgattctg
attctgattgtgcggcccaccgggattctgggtgaacgggtggcggaaaagatatga

DBGET integrated database retrieval system