Desulfobulbus oralis: CAY53_03960 Help Entry CAY53_03960       CDS       T05339                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism deo  Desulfobulbus oralis Pathway deo01100   Metabolic pathways deo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:deo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CAY53_03960    00074 Mycolic acid biosynthesis     CAY53_03960   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CAY53_03960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TRI4_N Motif Other DBs NCBI-ProteinID:  AVD70740 UniProt:  A0A2L1GM26 LinkDB All DBs Position 910882..911154 Genome browser AA seq 90 aa AA seqDB search MTREELQAQLTQILEQDFEFSNVAPGDNLRDVHGFDSIDAIELLAKLEKLLGFSISREER EGAMRIRTLADILDYIETLQKKRAEDGGGA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacccgagaagaactgcaggcgcaactcacccaaattctggagcaggattttgaattc agcaacgtggctccaggcgacaatctgcgcgatgtgcacggctttgacagtatcgatgcc attgaacttttggccaagctcgaaaaactcctgggcttttccatcagccgcgaggagagg gaaggcgccatgcgcatccgcacgcttgccgacattctggactatatcgagacgctccaa aagaagcgggccgaagacggcgggggcgcatga

DBGET integrated database retrieval system