Desulfobulbus oralis: CAY53_11685 Help Entry CAY53_11685       CDS       T05339                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism deo  Desulfobulbus oralis Pathway deo01100   Metabolic pathways deo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:deo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CAY53_11685    00074 Mycolic acid biosynthesis     CAY53_11685   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CAY53_11685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AVD72347 UniProt:  A0A2L1GRU8 LinkDB All DBs Position 2620423..2620677 Genome browser AA seq 84 aa AA seqDB search MEELKGKLIALLNLQDVQPEDFDPDARLVGGDLGIDSIDVLEMVVMVEKDYGVTINNQEM GQQVFASLRQLADYIRRHRVADLP NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggaagaactgaagggcaaactgattgccctgttgaatttgcaggatgtgcagccggaa gatttcgacccggacgcccggctggtaggcggcgatttgggcattgactccatcgatgtt ctggagatggtggtcatggtggaaaaggactacggcgtgaccatcaacaaccaggaaatg gggcagcaggtctttgccagcctgaggcaactggccgactacatccgccggcacagggtg gcggacctgccttga

DBGET integrated database retrieval system