Desulfuromonas sp. AOP6: AOP6_1833 Help Entry AOP6_1833         CDS       T08366                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism dep  Desulfuromonas sp. AOP6 Pathway dep02024   Quorum sensing dep03018   RNA degradation Brite KEGG Orthology (KO) [BR:dep00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AOP6_1833 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AOP6_1833 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:dep03019]     AOP6_1833 (hfq)    03036 Chromosome and associated proteins [BR:dep03036]     AOP6_1833 (hfq) Messenger RNA biogenesis [BR:dep03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AOP6_1833 (hfq) Chromosome and associated proteins [BR:dep03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AOP6_1833 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Motif Other DBs NCBI-ProteinID:  BCA80046 LinkDB All DBs Position complement(1976807..1977040) Genome browser AA seq 77 aa AA seqDB search MAKTPFNIQDQYLNQARKERVKVIVMMMSGEKLTGYIKSFDSFCLLVESSGDILLYKHAI SSITSADGAFRLHGGKD NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggccaagaccccgttcaatatccaggatcagtacctcaaccaggcccgcaaggagcgg gtcaaggtaatcgtgatgatgatgtccggcgaaaaactgaccgggtatatcaagtctttc gacagcttctgtctgcttgttgaaagcagcggtgatattctgctctacaagcatgccatc agttcgatcacctcagctgacggtgccttccgtctccatgggggcaaggactag

DBGET integrated database retrieval system