Desulfuromonas sp. AOP6: AOP6_2690 Help Entry AOP6_2690         CDS       T08366                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism dep  Desulfuromonas sp. AOP6 Pathway dep03060   Protein export dep03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:dep00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AOP6_2690  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AOP6_2690  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:dep02044]     AOP6_2690 Secretion system [BR:dep02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    AOP6_2690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF7752 Motif Other DBs NCBI-ProteinID:  BCA80903 LinkDB All DBs Position complement(2905529..2905723) Genome browser AA seq 64 aa AA seqDB search MFGLGTQELLIILALVLIIFGAGKLPQVGGALGKGLRNFKQGIKEENEEQEDEKKKISDD KKED NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgttcggtctcggaactcaggaactgctcatcattcttgcattggtgctcatcattttc ggcgctggaaagttgccgcaggtcggcggcgctctgggaaaaggtctgcgtaacttcaag cagggaatcaaggaagagaacgaagagcaagaggacgagaagaaaaaaatatccgacgac aagaaggaagactga

DBGET integrated database retrieval system