Devosia sp. H5989: XM25_05345 Help Entry XM25_05345        CDS       T04003                                  Name (GenBank) membrane protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism deq  Devosia sp. H5989 Pathway deq00190   Oxidative phosphorylation deq01100   Metabolic pathways deq02020   Two-component system Module deq_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:deq00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     XM25_05345  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     XM25_05345 Enzymes [BR:deq01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      XM25_05345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB ATP-synt_I Motif Other DBs NCBI-ProteinID:  AKR55240 LinkDB All DBs Position 1135170..1135274 Genome browser AA seq 34 aa AA seqDB search MWYFSWILGVSLACSFSILNAMWFELREDKKNGR NT seq 105 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttttcttggatcctgggcgtaagcctggcctgcagctttagcattctcaac gccatgtggtttgagctgcgcgaagacaagaagaacggcaggtaa

DBGET integrated database retrieval system