Devosia sp. H5989: XM25_07315 Help Entry XM25_07315        CDS       T04003                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism deq  Devosia sp. H5989 Pathway deq03060   Protein export deq03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:deq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     XM25_07315  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     XM25_07315  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:deq02044]     XM25_07315 Secretion system [BR:deq02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    XM25_07315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF4179 Motif Other DBs NCBI-ProteinID:  AKR55613 LinkDB All DBs Position complement(1539640..1539855) Genome browser AA seq 71 aa AA seqDB search MHAPGIWGILVVAVVVLLLFGRGKISGMMGEVASGIKAFQKGMRDEETKPAQIDANAKVN AASETEKSKDA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgcacgcgccaggaatttggggtattctcgttgtggcagtcgtcgtgctgttgctcttt ggccggggcaagatctccggcatgatgggtgaggtggcttcgggcatcaaagccttccag aagggtatgcgcgacgaagaaaccaagccggcccagatcgacgccaatgcgaaggtcaac gctgccagcgagaccgagaaaagcaaggacgcctga

DBGET integrated database retrieval system