KEGG   Devosia sp. H5989: XM25_22235
Entry
XM25_22235        CDS       T04003                                 
Name
(GenBank) Melibiose operon regulatory protein
  KO
K23237  AraC family transcriptional regulator, melibiose operon regulatory protein
Organism
deq  Devosia sp. H5989
Brite
KEGG Orthology (KO) [BR:deq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:deq03000]
    XM25_22235
Transcription factors [BR:deq03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    XM25_22235
SSDB
Motif
Pfam: HTH_18 HTH_AraC Cupin_2 AraC_binding Cupin_1
Other DBs
NCBI-ProteinID: AKR58462
LinkDB
Position
complement(4536633..4537535)
AA seq 300 aa
MPESKVRPIYQPGASSVEGLPTSFQMFHNTPLVMVKPHWHAQVEVNFIVRGTVHYRMHTH
EMTLQAGQMCLFWGGLAHQMDDLSEDTIYAGAHLPLIHFFRLRLPQDVPQQLMQGATLLT
EATDVSDAHNFARWNAYARSGDAVRAEQAVNELLLRLERVRFEPYSLVGGSAESGEASQS
EGFDLQSSRKVGRMCDFIAQNFLHDIDSIDIASAADLHPKYAMSIFKRSTGMTLNEYVNL
LRLSYAQALLLREDANVLHVAMESGFGSLSAFNKSFRKMAGMSPSDFRRDAGAVPEQRFG
NT seq 903 nt   +upstreamnt  +downstreamnt
ttgccggaaagtaaggtgcgtccgatctaccaacccggggcgagcagcgtcgaagggctg
ccgaccagtttccagatgttccacaacacgccgctggtgatggtcaaaccgcactggcac
gcacaggtggaagtcaatttcatcgttcgcggcacggtgcattatcgcatgcacacccac
gaaatgacgttgcaggccgggcagatgtgcctgttttggggcggactggcccaccagatg
gacgatctttccgaagacaccatctatgccggggcgcacctgccgctcatccacttcttc
cggctgcgcctgccacaggacgtgccccagcagctgatgcagggcgccacgctcctgacc
gaggcgacggacgtgtcggacgctcacaatttcgcgcgctggaacgcctatgcccgctcg
ggcgacgcggtgcgggccgagcaggccgtcaacgaactgctgctgcggctggaacgggtg
cggttcgagccctattcgctggtcggggggagcgcggagagcggcgaggcgagccagagc
gaggggttcgacctgcaatcgtcgcgcaaggtgggcaggatgtgcgatttcatcgcgcag
aatttcctccacgacatcgattcgatcgacatcgcctcggcggcggacctgcatccgaaa
tacgccatgtcgatcttcaagcgctcaacgggcatgacgctcaacgaatacgtgaacctc
ctgcggctctcctacgcccaggcgctgctgctgcgcgaggatgccaacgtgctgcacgtg
gcgatggaaagcgggttcggctcgctcagcgccttcaacaagtcgttccgcaagatggcg
gggatgtcgccctccgacttccggcgcgatgcgggggcggttccggagcagcggttcggc
taa

DBGET integrated database retrieval system