Drosophila erecta: 26526401 Help Entry 26526401          CDS       T01060                                  Name (RefSeq) immune-induced peptide 3   KO K20695   immune-induced peptide 1/2/3 Organism der  Drosophila erecta Pathway der04624   Toll and Imd signaling pathway Brite KEGG Orthology (KO) [BR:der00001]  09150 Organismal Systems   09151 Immune system    04624 Toll and Imd signaling pathway     26526401 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DIM Motif Other DBs NCBI-GeneID:  26526401 NCBI-ProteinID:  XP_015015500 UniProt:  A0A0Q5WLT4 LinkDB All DBs Position Unknown AA seq 60 aa AA seqDB search MDSMEQCISSVCTSVLPTSKMKFLSVAFLLGLLALSSATPLNPGNVIINGDCRVCNVHGG NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggattcgatggagcaatgcatcagttcagtttgcacctctgttctacctacttcaaag atgaaattcctttcggttgcctttctgctcggccttttggctctaagcagcgctactcct ctgaatcccggcaatgtcataatcaatggagattgccgagtctgcaacgttcacggcgga taa

DBGET integrated database retrieval system