Drosophila erecta: 6542570 Help Entry 6542570           CDS       T01060                                  Name (RefSeq) neo-calmodulin   KO K02183   calmodulin Organism der  Drosophila erecta Pathway der04070   Phosphatidylinositol signaling system der04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:der00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     6542570  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     6542570  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:der01009]     6542570   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:der04131]     6542570    03036 Chromosome and associated proteins [BR:der03036]     6542570   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:der04147]     6542570 Protein phosphatases and associated proteins [BR:der01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      6542570 Membrane trafficking [BR:der04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     6542570 Chromosome and associated proteins [BR:der03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      6542570 Exosome [BR:der04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    6542570 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C Dockerin_1 DUF5580_M RNA_pol_Rpb4 DUF7683 Motif Other DBs NCBI-GeneID:  6542570 NCBI-ProteinID:  XP_001968619 UniProt:  B3N379 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MDELTTEEQDLFKKTFKILDTENEGAITSKELGLVIRAIGRQPNEAEVQSLINEVDSDGN GTISAAEFYNVILRKMRDTSKEEELRDAFSVFDKENNGYISATELRAVFMALGEKLEDDE LEEMIREYDVDQDNHINFEEFTNMMTTR NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggatgaattgaccactgaggagcaggacctgttcaaaaaaacctttaagatattggac acggagaacgaaggagccatcacctcgaaggaattgggactggtaattcgcgcaataggt cggcagcccaacgaagcggaggttcagtccttgataaacgaggtggactccgatggaaat ggaaccatttcggctgccgagttttacaatgtgattctgcgcaagatgcgtgacacaagt aaggaggaggagctgcgcgatgcctttagtgtttttgataaggagaacaatgggtacata tccgctaccgagttgagggctgtcttcatggcacttggcgaaaaattggaagacgacgag ctggaggagatgatacgcgagtacgatgtcgatcaggacaatcacatcaatttcgaggag tttaccaacatgatgaccacgcgttag

DBGET integrated database retrieval system