Drosophila erecta: 6543567 Help Entry 6543567           CDS       T01060                                  Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism der  Drosophila erecta Brite KEGG Orthology (KO) [BR:der00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:der03036]     6543567 Chromosome and associated proteins [BR:der03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      6543567     MLL-HCF complex      6543567     MLL3/MLL4 complex      6543567 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dpy-30 Motif Other DBs NCBI-GeneID:  6543567 NCBI-ProteinID:  XP_001971827 UniProt:  B3NG24 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MPVYPVEAEFNGGGDVAKNDSNSQQSVEGADAFAACQKPRPDVSSMPVRQYLDQTVAPIL LHGLQALARDRPSDPISYLATYLLKNKNRCDEIKMDEN NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgccagtctacccagtagaggcggaattcaatggcggcggagatgtggccaagaacgac tccaactcgcagcaatcggtggagggagccgatgcattcgccgcctgccagaagccgcgt ccggatgtcagttccatgccggttcgccagtacctcgaccagacagtggcccccattttg ctccacggactgcaggctttggcccgggatcgacccagtgatccgatcagttacttggct acctatctgttgaagaacaagaatcgctgcgacgagatcaagatggatgaaaactaa

DBGET integrated database retrieval system