Drosophila erecta: 6544305 Help Entry 6544305           CDS       T01060                                  Name (RefSeq) ras-related protein Rac2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism der  Drosophila erecta Pathway der04013   MAPK signaling pathway - fly der04145   Phagosome der04148   Efferocytosis der04310   Wnt signaling pathway der04517   IgSF CAM signaling der04518   Integrin signaling der04620   Toll-like receptor signaling pathway der05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:der00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     6544305    04310 Wnt signaling pathway     6544305   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     6544305    04518 Integrin signaling     6544305  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     6544305    04148 Efferocytosis     6544305  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     6544305  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     6544305  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:der04131]     6544305   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:der04147]     6544305    04031 GTP-binding proteins [BR:der04031]     6544305 Membrane trafficking [BR:der04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     6544305  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     6544305   Macropinocytosis    Ras GTPases     6544305  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     6544305 Exosome [BR:der04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6544305   Exosomal proteins of other body fluids (saliva and urine)    6544305   Exosomal proteins of colorectal cancer cells    6544305   Exosomal proteins of bladder cancer cells    6544305 GTP-binding proteins [BR:der04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     6544305 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  6544305 NCBI-ProteinID:  XP_026832693 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLR DDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPV VRGPKRHKCALL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgtgtggttgtgggcgacggagcggtgggtaagacctgcctgctg atcagctatacgaccaacgccttcccgggcgagtacatacccacggtgttcgacaactac tcggcgaatgtgatggtggatgccaagcccatcaatttgggcctctgggatacggctggt caggaggactacgatcggctgcggccgctatcctatccgcaaacggatgtgttcctcatc tgtttctccctggtcaatcccgcatcgtttgagaatgtgcgtgccaagtggtttccggag gtgcgtcatcactgccccagtgtgcccatcatcctggttggcaccaaactggatctgcgc gacgataagcagaccatcgaaaagctgaaggacaagaagctaacgccgatcacctatccg cagggactggcgatggccaaggaaatagccgcggtcaagtatctggagtgctcggccctc acccaaaagggtctgaagacggtcttcgacgaggccatacgatctgtgctatgtcccgtg gttcgcgggcccaagcgacacaagtgcgccctgctctag

DBGET integrated database retrieval system