Drosophila erecta: 6545938 Help Entry 6545938           CDS       T01060                                  Name (RefSeq) drosomycin   KO K20670   drosomycin Organism der  Drosophila erecta Pathway der04624   Toll and Imd signaling pathway Brite KEGG Orthology (KO) [BR:der00001]  09150 Organismal Systems   09151 Immune system    04624 Toll and Imd signaling pathway     6545938  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:der02000]     6545938 Transporters [BR:der02000]  Other transporters   Accessory factors involved in transport [TC:8]    6545938 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gamma-thionin Toxin_3 Defensin Motif Other DBs NCBI-GeneID:  6545938 NCBI-ProteinID:  XP_001971738 UniProt:  B3NBU7 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search MAQIKGLFAVLAVVAIVLMAANSSSAVDCQSGTFSGPCWAWDGEQCRRLCREEGHVSGHC SASLKCWCEQC NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggctcagattaaaggcttgttcgctgtgctcgctgtggtggccattgtcctaatggcc gccaactcgtcttcggctgtggattgccagtctggaactttcagtggtccttgctgggcc tgggatggagagcagtgccgtcgcctctgcagggaggaaggacatgtcagtggacactgc agtgccagcctgaagtgctggtgcgaacaatgctga

DBGET integrated database retrieval system