Drosophila erecta: 6546022 Help Entry 6546022           CDS       T01060                                  Name (RefSeq) probable insulin-like peptide 5   KO K04526   insulin Organism der  Drosophila erecta Pathway der04068   FoxO signaling pathway der04081   Hormone signaling der04140   Autophagy - animal der04150   mTOR signaling pathway der04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:der00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     6546022    04150 mTOR signaling pathway     6546022   09133 Signaling molecules and interaction    04081 Hormone signaling     6546022  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     6546022  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     6546022  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:der04052]     6546022 Cytokines and neuropeptides [BR:der04052]  Neuropeptides   Unclassified    6546022 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  6546022 NCBI-ProteinID:  XP_001972234 UniProt:  B3NGM4 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MRRKLHHILSSSSSSKAMMFRSVIPVLLLLIPLLLSAEAANSVRACGPELLDLLRVACPN GFNSMFVKRGSLGLFDYEDLLTDQDSSDSHPHHMNSLSSLRRDFRGIVDACCRKPCNFVT LRTYCLS NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgcggcggaaactgcaccacatcctatccagcagcagttccagcaaggcaatgatgttc cgctccgtgatcccagtgctcctgctcctgatcccgctcctgctgtccgcagaggccgca aactcggtgcgggcttgtggcccggaattgttggacttgctgagggtggcctgtcccaat ggattcaattccatgttcgtcaagcgaggctccctggggctattcgattatgaggacctc ttgaccgatcaggatagctccgattctcaccctcaccacatgaactcgctgtccagcctt cggcgcgattttcgaggcattgtagatgcctgttgccgcaaaccgtgcaacttcgtcacg ttgaggacatactgcctttcctaa

DBGET integrated database retrieval system