Drosophila erecta: 6546902 Help Entry 6546902           CDS       T01060                                  Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism der  Drosophila erecta Pathway der04814   Motor proteins Brite KEGG Orthology (KO) [BR:der00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     6546902  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:der03037]     6546902    04812 Cytoskeleton proteins [BR:der04812]     6546902 Cilium and associated proteins [BR:der03037]  Motile cilia and associated proteins   Dynein arm    6546902 Cytoskeleton proteins [BR:der04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      6546902 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Leuk-A4-hydro_C Motif Other DBs NCBI-GeneID:  6546902 NCBI-ProteinID:  XP_001975981 UniProt:  B3NS79 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MADEEGGKEGEKKIVHVYPLVKHTDMNEEMRIEAIELSITACEKYSSNYEHAAKIIKENM DKKFGIYWHVVVGEGFGFEVSYETENILYLFFAGNLAIVLWKCS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcggacgaggagggcggtaaggagggcgagaagaaaatcgtgcacgtttatcctctg gtgaagcacactgacatgaacgaggagatgcggatagaggccattgaactgtccattacc gcctgcgaaaaatattcgtccaattacgagcacgctgccaaaatcatcaaggaaaacatg gacaagaagtttggcatctattggcatgtggttgtgggcgaagggttcggctttgaggtc tcctacgagacggagaacattctctacctgttcttcgccggcaacctggccatcgtgctg tggaagtgctcctga

DBGET integrated database retrieval system