KEGG   Drosophila erecta: 6550295
Entry
6550295           CDS       T01060                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
der  Drosophila erecta
Pathway
der00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    6550295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:der00199]
    6550295
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     6550295
Cytochrome P450 [BR:der00199]
 Cytochrome P450, animal type
  CYP306 family
   6550295
SSDB
Motif
Pfam: p450 DUF4471
Other DBs
NCBI-GeneID: 6550295
NCBI-ProteinID: XP_001977697
FlyBase: FBgn0111386
UniProt: B3NUM7
LinkDB
Position
Unknown
AA seq 581 aa
MSAGIVDMGCTGWWMPSAQSLSVLLVPGVLVLVILYLCEHQYDDILGVSPPGPWGLPLLG
YLPFLDAHAPHKSLQRLAKRHGGIFELKMGRVRTVILSDAALVRDFFRRDVMSGRAPLYL
THGIMGGFGIICAQLDLWRHARRETIDWLKALGMTRRPGELRARLERRIARGVDECVRLF
ETEAQKSCASEVDPLPALHHTLGNIINDLVFGITYKRDDPDWLYLQRLQEEGVKLIGVSG
VVNFLPWLRHLPANERNIRFLLEGKAKTHAIYDRIVEACAQRLKEKQQAFQELQERKRVQ
RQLEKEQRRQSTEADPSQEKSVPESEAREDEDEEESYEEDVYEPESILEHFLAVRDTDSQ
LYCDDQLRHLLADLFGAGVDTSLATLRWFLLYLAREQRCQRRLHELLLPLGSSPTLEELE
PLDYLRACISETMRIRSVVPLGIPHGCKEDFVMGDYNIKGGSMIVCLEWAIHMDPVAFPE
PEEFRPERFLTPEGTYQAPPQFIPFSSGYRMCPGEDMARMLLTLFAGRIMRSFHLELPPG
AVVDMAGESGITLTPAPHRLRFTKLPAVEMRREPDGAVVQD
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgtcggcgggaatcgtcgacatgggctgcaccggttggtggatgccctcggcgcagagc
ctgagtgtgctgctggttccgggtgtgctggtcctggtgattctctacctgtgcgagcac
cagtacgacgacatactgggtgtctcgccgccgggtccctggggcctgccattgctgggc
tacctgcccttcctggacgcccatgcgccgcacaagtcactccagcggctggccaagcgg
catggcggcatctttgagctgaaaatgggccgggtgcgcaccgtaatcctctcggatgcc
gccctggtgcgggatttctttcgccgcgatgtgatgagtggccgggcgccgctctacctc
acccacggcatcatgggcggatttggcatcatctgcgcccagctggacctttggcgccat
gcgcggcgcgagaccatcgattggctgaaggccttgggcatgacccgtcggccgggggag
ctgcgcgcccggctggagcggcgcatcgcccgcggggtcgacgagtgcgtccggctcttc
gagacggaggcgcagaagagctgtgcgtcggaagtggatccgctgccggcgctccaccac
acgctgggcaacatcatcaacgacctggtcttcgggatcacctacaagcgggacgacccc
gactggctgtacctgcagcggctgcaggaggagggcgtcaagctgattggcgtctccggg
gtggtgaacttcctgccctggctgcgccacctgcccgccaacgagcgcaacatccgcttc
ctgctggagggcaaggccaagacgcacgccatctacgaccgcatagtggaggcctgtgcc
cagcggctgaaggagaagcagcaggcgttccaggagctccaggagcggaagcgcgtgcag
aggcagctggagaaggagcagcggcgacagtcaacggaggcggatcccagccaggagaag
agtgtgccggaaagtgaggcgagggaggacgaggatgaggaggagagctacgaggaggac
gtgtacgagccggagagcatcctggagcacttcctcgccgtacgagacacggactcgcag
ctctactgcgacgaccagctgcgtcatctgctggccgatctgtttggagccggggtggac
acctcactggccaccctgcgctggttcctgctctacttggcccgcgagcaacgctgccag
cggcggctgcatgagctcctcctgccgctgggttcgtcgcccactttggaggagctggag
ccgctggactacctgagggcctgcatttccgagacgatgcgcatacgcagcgtggtccca
ctgggcattccgcacggatgcaaagaggacttcgtcatgggcgactataacatcaagggc
ggttcgatgatcgtttgcctggagtgggccattcacatggatcccgtggcgttcccggaa
ccggaggagttccgcccggagcgtttcctgacccccgagggcacctaccaggcgccgcca
cagttcatcccattctcctccggctaccgcatgtgccccggcgaagacatggctcgcatg
ttactcacgctcttcgcgggtcgcatcatgaggtccttccacctggagctgcccccgggc
gcagtggtggacatggcgggcgagagcggcatcaccctgactcctgctccgcacaggctg
cgattcaccaagctgcctgcggtggagatgcgccgtgaacccgacggcgctgtggtgcag
gattag

DBGET integrated database retrieval system