Drosophila erecta: 6550501 Help Entry 6550501           CDS       T01060                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism der  Drosophila erecta Pathway der04144   Endocytosis der04517   IgSF CAM signaling der04518   Integrin signaling der05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:der00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     6550501    04518 Integrin signaling     6550501  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     6550501  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     6550501  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:der04131]     6550501    03036 Chromosome and associated proteins [BR:der03036]     6550501   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:der04147]     6550501    04031 GTP-binding proteins [BR:der04031]     6550501 Membrane trafficking [BR:der04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     6550501  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     6550501   Macropinocytosis    Ras GTPases     6550501 Chromosome and associated proteins [BR:der03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     6550501 Exosome [BR:der04147]  Exosomal proteins   Exosomal proteins of microglial cells    6550501   Exosomal proteins of breast milk    6550501 GTP-binding proteins [BR:der04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     6550501 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  6550501 NCBI-ProteinID:  XP_001977816 UniProt:  B3NVS8 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLR DETSTLEKLAKNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPTKKRKCKFL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcaaaccatcaagtgcgtggtcgtcggcgacggagctgtgggtaagacatgcctgctc atctcctacacaaccaacaagttcccatcggagtacgtgccgacggtgttcgacaactat gcagtcaccgtgatgatcggcggtgagccctacacactgggtttgttcgatacggccgga caggaggactacgatcggctgcgtccgctttcctatccccagacggatgtcttcctggtc tgcttctcggtggtcagtcccagttccttcgagaacgtcaaagagaagtgggtgcccgag atcacacaccattgccaaaagacaccgttcctgctggtgggcacccagattgatctgcgc gacgagaccagtacgctggagaagctggccaagaataagcaaaagcccatcaccatggag cagggcgagaagctggccaaggagctgaaggccgtcaagtacgtggagtgctcggccttg acacagaagggcctgaaaaatgtattcgacgaggccatcctggccgctctggagccacca gagcccacaaagaaaaggaagtgcaaattcttataa

DBGET integrated database retrieval system