Drosophila erecta: 6553757 Help Entry 6553757           CDS       T01060                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism der  Drosophila erecta Pathway der04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:der00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     6553757  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:der04121]     6553757    03400 DNA repair and recombination proteins [BR:der03400]     6553757 Ubiquitin system [BR:der04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      6553757    Cul5 complex      6553757 DNA repair and recombination proteins [BR:der03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      6553757 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD GABP-alpha Motif Other DBs NCBI-GeneID:  6553757 NCBI-ProteinID:  XP_001979417 UniProt:  B3NYX2 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMIRRQKTTIFTDAKENTTVAELKRMIEGILKVQPVDQRLYNQDNDVMEDDSTLQD YGVTVSTAKAQAPAQLGLTFRNEVGDFETLDMTPYSAPPDLPEVMKNQEASNGQEQVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatcaggcggcaaaagaccaccatcttcacggacgccaaggag aacacaacagtggccgagctgaagcgaatgattgagggcatactgaaggtgcagcccgtg gatcagcggttatacaatcaggacaacgatgtcatggaggacgatagcacgttgcaggac tacggtgtgacggtgtccacggccaaggcgcaggctccggcgcagctgggtttgacattc aggaacgaggtgggcgactttgagacactggacatgacaccctactcggcaccaccagac ttacccgaagtcatgaaaaaccaagaggcgtcgaacggacaggagcaggttgcataa

DBGET integrated database retrieval system