Drosophila erecta: 6555071 Help Entry 6555071           CDS       T01060                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism der  Drosophila erecta Pathway der04137   Mitophagy - animal der04140   Autophagy - animal der04144   Endocytosis der04145   Phagosome der04148   Efferocytosis Brite KEGG Orthology (KO) [BR:der00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     6555071    04145 Phagosome     6555071    04140 Autophagy - animal     6555071    04137 Mitophagy - animal     6555071    04148 Efferocytosis     6555071  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:der04131]     6555071   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:der04147]     6555071    04031 GTP-binding proteins [BR:der04031]     6555071 Membrane trafficking [BR:der04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     6555071 Exosome [BR:der04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6555071   Exosomal proteins of other body fluids (saliva and urine)    6555071   Exosomal proteins of colorectal cancer cells    6555071   Exosomal proteins of bladder cancer cells    6555071 GTP-binding proteins [BR:der04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     6555071 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase AAA_16 Septin nSTAND3 SRPRB ATPase_2 TniB DUF7677 Motif Other DBs NCBI-GeneID:  6555071 NCBI-ProteinID:  XP_001982062 UniProt:  B3P8A8 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPEHFPF VVLGNKVDLDNRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEA EVINDFPDQITLGSQNNRPGNPDNCQC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgtaagaaatccctgctgaaagtcatcattctgggcgacagcagtgtgggc aagacctcgctgatgaatcagtatgtaaacaaacgcttctccaaccaatacaaagccacg atcggagcagatttctgcacgaaagaggtggttgtcaacgatcgagtggtcacaatgcag atctgggacactgctggtcaggaacgcttccagtcgcttggagtggccttttaccgcgga gccgactgctgtgtgcttgtctacgatgtgacggcgcccaactcgttcaagaatctcgac tcctggcgcgacgagttcctcatacaggccagtccacgggatcccgagcacttccccttc gtggtattgggcaataaggtggatttggacaaccgccaggtgtctacgcgtcgagcgcag cagtggtgccaatctaagaacgatataccctactacgaaacgtccgccaaggagggcatc aacgtggaaatggcgtttcaagttatagccaagaatgcgctagagctggaggcggaggct gaggttatcaacgatttccccgatcagatcaccttgggctcgcaaaacaatcgtcctggc aatcccgacaactgtcagtgctaa

DBGET integrated database retrieval system