Drosophila erecta: 6555537 Help Entry 6555537           CDS       T01060                                  Name (RefSeq) probable insulin-like peptide 6   KO K05459   insulin-like growth factor 1 Organism der  Drosophila erecta Pathway der04068   FoxO signaling pathway der04081   Hormone signaling der04150   mTOR signaling pathway der04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:der00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     6555537    04150 mTOR signaling pathway     6555537   09133 Signaling molecules and interaction    04081 Hormone signaling     6555537  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     6555537  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:der04052]     6555537 Cytokines and neuropeptides [BR:der04052]  Cytokines   Growth factors (RTK binding)    6555537 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  6555537 NCBI-ProteinID:  XP_026838362 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MIPEVATTKVLLVLATVLAVAALISSWVPQVAGSPLAPVEYEQRRTICSNGLSDLIQKIC VGGTVALGDVFPNSFGKRRKRDMPNVTDLCCKPGGCTYRELLQYCKG NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgattcccgaagtggcgaccaccaaagtcctgctagtcctggccaccgtgctcgctgtg gcggcgctgatcagcagttgggtgccccaggtggcgggcagtccactcgcacctgtggaa tacgagcagagacgcacgatttgctccaatggcctcagcgatttgatacagaagatatgc gtgggcggaacggtggctctcggcgatgtttttcccaacagttttgggaagcgcaggaag cgcgacatgccgaacgtgaccgatttgtgctgcaagccaggtggatgcacctacagggag ctcttgcagtactgcaagggatga

DBGET integrated database retrieval system