Desulfuromonas soudanensis: DSOUD_1235 Help Entry DSOUD_1235        CDS       T04049                                  Symbol acpP-1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism des  Desulfuromonas soudanensis Pathway des01100   Metabolic pathways des01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:des00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSOUD_1235 (acpP-1)    00074 Mycolic acid biosynthesis     DSOUD_1235 (acpP-1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSOUD_1235 (acpP-1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ALC16016 UniProt:  A0A0M4CVY4 LinkDB All DBs Position 1370173..1370427 Genome browser AA seq 84 aa AA seqDB search MTIKEKLKKLLVEELNLEDMTPEEILDDAPLFGEGLGLDSLDAVELVVLVQKHFGVEIKD MDEGRPALQSVATLAAFIEEKQGK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgacgatcaaggaaaaactcaagaagctgctggtggaagaactcaacctggaggatatg acccccgaggagatcctcgatgacgcccccctcttcggcgaagggctcggcctcgactcc ctcgatgccgtcgaactggtggtcctggtgcagaagcacttcggcgtggagatcaaggac atggacgaagggcgtcccgccctgcagtccgttgccaccctggcggccttcatcgaagag aagcaaggcaaatga

DBGET integrated database retrieval system