Desulfuromonas sp. DDH964: DBW_1786 Help Entry DBW_1786          CDS       T04368                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism deu  Desulfuromonas sp. DDH964 Pathway deu01100   Metabolic pathways deu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:deu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DBW_1786    00074 Mycolic acid biosynthesis     DBW_1786   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DBW_1786 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AMV72143 UniProt:  A0A143B7T5 LinkDB All DBs Position 1918971..1919243 Genome browser AA seq 90 aa AA seqDB search MSEALMAELREMIFATCNVEDVDPDELGPDDPLTGPDSMLGLDSIDAVEIVVEVQKKYDV RIGGKEISREILTSLRTLADFLIGEGVTAS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtctgaagcactgatggcggaactgcgcgaaatgatctttgccacctgcaacgtggag gatgtcgatcccgacgagcttggccccgacgacccgttgaccgggcccgactccatgctc ggcctcgattcgatcgacgcggtggagatcgtcgtcgaggtccagaagaaatacgacgtc cgcatcggcggcaaggagatcagtcgcgagatcctgacttcgttgcggacgctggctgat tttctgatcggggaaggggtcacggcttcctga

DBGET integrated database retrieval system