Desulfuromonas sp. DDH964: DBW_2701 Help Entry DBW_2701          CDS       T04368                                  Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism deu  Desulfuromonas sp. DDH964 Brite KEGG Orthology (KO) [BR:deu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:deu03036]     DBW_2701 Chromosome and associated proteins [BR:deu03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     DBW_2701 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB NRBF2 YabA ACBP4_C bZIP_1 ADIP DivIC Herpes_UL6 V_ATPase_I Lipoprotein_19 YvrJ Prominin EMP24_GP25L Motif Other DBs NCBI-ProteinID:  AMV73013 UniProt:  A0A143BAA2 LinkDB All DBs Position complement(2861604..2861795) Genome browser AA seq 63 aa AA seqDB search MDLTVIVRLEEKVDQLLDELQTLQEENLRLRERQARLEEERQVFRRELDLVLGKLPAKER RAP NT seq 192 nt NT seq  +upstreamnt  +downstreamnt gtggatttaaccgtcattgtccgcctggaagagaaggtcgaccagctcctcgatgagctg cagaccctgcaggaggaaaatctccgcctgcgggagcgtcaggcgcgcctggaagaggaa cgccaggtctttcggcgcgagcttgacctggtacttggcaaactgccggcgaaggagcgc agggcgccttga

DBGET integrated database retrieval system