Devosia sp. D6-9: GHV40_11380 Help Entry GHV40_11380       CDS       T10671                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism devd  Devosia sp. D6-9 Brite KEGG Orthology (KO) [BR:devd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:devd03032]     GHV40_11380    03036 Chromosome and associated proteins [BR:devd03036]     GHV40_11380    03400 DNA repair and recombination proteins [BR:devd03400]     GHV40_11380 DNA replication proteins [BR:devd03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GHV40_11380 Chromosome and associated proteins [BR:devd03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GHV40_11380 DNA repair and recombination proteins [BR:devd03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GHV40_11380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 DUF2267 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QMV02041 LinkDB All DBs Position 2326319..2326594 Genome browser AA seq 91 aa AA seqDB search MSNKNDLIGAVAEKAEITKAQAAAAVDAVFDAITASLKANDEVRLVGFGTFSVSKRKATT GRNPATGAEIKIPASNQAKFKPGKGLKDAIN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgtcgaacaaaaacgatctgatcggcgctgtcgccgagaaggccgaaatcaccaaagct caggctgctgctgcagtcgacgcggtcttcgacgcgatcaccgcttcgctcaaggcgaac gatgaggttcggttggtcgggtttggtacgttctcggtctccaagcgcaaggccaccacg ggccgcaatcctgctaccggcgccgagatcaagattccggcttccaaccaggccaagttc aagcccggcaagggcctgaaggacgcgatcaactaa

DBGET integrated database retrieval system