Defluviicoccus sp. SSA4: HWD60_04270 Help Entry HWD60_04270       CDS       T06717                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dex  Defluviicoccus sp. SSA4 Pathway dex01100   Metabolic pathways dex01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dex00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HWD60_04270    00074 Mycolic acid biosynthesis     HWD60_04270   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HWD60_04270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QLH38330 UniProt:  A0A7D5MUZ0 LinkDB All DBs Position complement(869671..869931) Genome browser AA seq 86 aa AA seqDB search MPEDERLRAAILETLKQVAPEADTAALDPNKSFRDQVGLDLIDFLNFVVGLEERFELRII ETDYPQLSSLQGCLDYIAAHRTPASS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcccgaagacgagcgattgcgagcggcaatcctggagaccctgaaacaggtcgcgccc gaagcggataccgcggcacttgacccgaacaagagcttccgcgaccaggtgggactcgat ctgatagactttctcaatttcgtcgtcgggctggaggaacggttcgaattgcgaatcatt gagaccgactacccgcaactctccagcctgcagggctgcctagactacatcgcagcccac cgcacgccggcatcaagctga

DBGET integrated database retrieval system