Defluviicoccus sp. SSA4: HWD60_16335 Help Entry HWD60_16335       CDS       T06717                                  Name (GenBank) rod-binding protein   KO K02395   peptidoglycan hydrolase FlgJ Organism dex  Defluviicoccus sp. SSA4 Pathway dex02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:dex00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     HWD60_16335  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:dex02035]     HWD60_16335 Bacterial motility proteins [BR:dex02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     HWD60_16335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  QLH40186 UniProt:  A0A7D5MWN6 LinkDB All DBs Position 3442585..3442809 Genome browser AA seq 74 aa AA seqDB search MLQPMFENLGDAAEPFGDGPGQDVWRSMQVEQYGKAIAAGGSIGLAERVARELITAQETY RGYNGQEARNGEPR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgctgcagccgatgttcgaaaacctgggcgacgcggcggagccgttcggcgacggcccg ggccaggacgtctggcgctcgatgcaggtcgaacaatacggcaaggcgatcgccgccggc ggcagcatcgggctcgccgagcgggtcgcgcgcgagttgatcacagcccaggaaacctat cgcggctataacggccaggaagcccgcaacggagaaccgcggtga

DBGET integrated database retrieval system