KEGG   Defluviicoccus sp. SSA4: HWD60_16480
Entry
HWD60_16480       CDS       T06717                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
dex  Defluviicoccus sp. SSA4
Pathway
dex00190  Oxidative phosphorylation
dex01100  Metabolic pathways
dex02020  Two-component system
dex04148  Efferocytosis
Module
dex_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:dex00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HWD60_16480 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HWD60_16480 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    HWD60_16480 (petA)
Enzymes [BR:dex01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     HWD60_16480 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske
Other DBs
NCBI-ProteinID: QLH41159
LinkDB
Position
complement(3477181..3477726)
AA seq 181 aa
MVSTSPPHPDEGETRRDFLLIATGAVGVAGAALAAWPFIDSMNPAADTLALASTGVDLAP
VAVGQRITVVWRGKPVFIDHRPEEEIKAAEDVDLAALVDPEPDSARVQKPEWLVVVGVCT
HLGCIPLGQKTGEPRSPYGGWFCPCHGSMYDTSGRIRQGPAPKNLVVPPYAFTDDTTIKI
G
NT seq 546 nt   +upstreamnt  +downstreamnt
atggtgtcaacctctcctccgcacccggacgaaggggagacgcgacgggacttcttgctg
atcgccacaggtgcggttggcgtggccggtgcggcgcttgccgcttggccgttcatcgac
agcatgaatccggcggcggatacgctggcgctggcgtcaaccggcgttgatcttgcgccg
gtggccgtcggccagcggatcaccgtcgtctggcgcggcaagcccgtgtttatcgaccac
cggccggaagaagaaatcaaagcggcggaagatgtcgatcttgcggcgctggtggatccc
gagccggacagcgcccgcgttcaaaagccggaatggctggttgtcgtcggcgtgtgcacg
cacctcggctgcatccctctgggacagaaaacgggcgagccccgcagcccttacggcggc
tggttctgcccgtgccacggctcgatgtacgacacttccggacggatccgtcaggggccc
gctccgaagaacctcgtggtgccgccttacgcttttaccgacgacaccaccatcaagatc
ggctga

DBGET integrated database retrieval system