Defluviicoccus sp. SSA4: HWD60_18175 Help Entry HWD60_18175       CDS       T06717                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism dex  Defluviicoccus sp. SSA4 Brite KEGG Orthology (KO) [BR:dex00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dex03110]     HWD60_18175 (grxC) Chaperones and folding catalysts [BR:dex03110]  Protein folding catalysts   Protein disulfide isomerase    HWD60_18175 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  QLH40478 UniProt:  A0A7D5RZW5 LinkDB All DBs Position 3832503..3832766 Genome browser AA seq 87 aa AA seqDB search MSHVEIYTTPFCPYCLRAKALLTKKGVAFQEIDVSEIPGARAEMQQRTDGARTVPQIFIG GKLIGGSDELVALERKGELDALLAVAG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt ttgagccacgttgaaatctacaccacgccgttctgcccctactgcctgcgggcgaaggcg ctgctgacgaagaaaggcgtggcatttcaggagatcgatgtctccgagattccgggcgca cgcgcggagatgcagcagcggacggacggtgcgcgcaccgttccgcagatcttcatcggc ggcaagctgatcggaggctccgacgagctcgtagcgctggagcgcaagggcgagctggac gcgctgcttgccgtcgccggctag

DBGET integrated database retrieval system