Dechloromonas sp. HYN0024: HYN24_04595
Help
Entry
HYN24_04595 CDS
T05616
Symbol
clpS
Name
(GenBank) ATP-dependent Clp protease adapter ClpS
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
dey
Dechloromonas sp. HYN0024
Brite
KEGG Orthology (KO) [BR:
dey00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
HYN24_04595 (clpS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
Coprogen_oxidas
Motif
Other DBs
NCBI-ProteinID:
AXS79368
LinkDB
All DBs
Position
complement(949735..950043)
Genome browser
AA seq
102 aa
AA seq
DB search
MATKAQEGGQLATQRSRLGPPKMFKVLLLNDDYTPMDFVITVLQRFFSLDTEQATQIMLK
VHNEGRGVCGIFPKDIAATKVEQVIAYARQHQHPLACIMEEN
NT seq
309 nt
NT seq
+upstream
nt +downstream
nt
atggcgacaaaggctcaagaaggcggacaactggcgacacagcgcagcaggctggggccg
ccaaagatgttcaaggtgctgctgctgaacgacgattacaccccgatggatttcgtcatc
accgttctgcagcggtttttttctctggatactgaacaagcaacgcaaatcatgctcaaa
gttcataacgagggtcgtggcgtctgcgggattttccccaaggatatcgctgcgaccaaa
gttgaacaggtcattgcctacgcacgccagcatcagcacccgcttgcctgcatcatggag
gaaaactga
DBGET
integrated database retrieval system