Dechloromonas sp. HYN0024: HYN24_09190 Help Entry HYN24_09190       CDS       T05616                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism dey  Dechloromonas sp. HYN0024 Brite KEGG Orthology (KO) [BR:dey00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dey03032]     HYN24_09190    03036 Chromosome and associated proteins [BR:dey03036]     HYN24_09190    03400 DNA repair and recombination proteins [BR:dey03400]     HYN24_09190 DNA replication proteins [BR:dey03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HYN24_09190 Chromosome and associated proteins [BR:dey03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HYN24_09190 DNA repair and recombination proteins [BR:dey03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HYN24_09190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 HU-HIG UBA_HYPK Motif Other DBs NCBI-ProteinID:  AXS80180 UniProt:  A0A3B7A5N9 LinkDB All DBs Position 1908997..1909269 Genome browser AA seq 90 aa AA seqDB search MNKTELIDSIATQADISKAAAGRALDAAVETIKAALKAGDTVNLIGFGTFYVGERAARTG RNPRTGKTLEIKAAKSPKFRAGKGLKDACN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagactgaactgatcgactccatcgccacccaagccgatatttccaaggcagct gccggccgtgcgctggatgccgccgttgaaaccatcaaggctgccctcaaggctggcgac acggtcaatctgatcggcttcggcactttctacgtcggtgagcgcgctgcccgtaccggg cgcaatccgcgcaccggcaagacccttgaaatcaaggccgccaagtcgccgaagttccgc gccggcaagggcctgaaagacgcctgcaactaa

DBGET integrated database retrieval system