Deinococcus irradiatisoli: DKM44_10975 Help Entry DKM44_10975       CDS       T05530                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dez  Deinococcus irradiatisoli Pathway dez01100   Metabolic pathways dez01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dez00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DKM44_10975 (acpP)    00074 Mycolic acid biosynthesis     DKM44_10975 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DKM44_10975 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N TMEM210 Motif Other DBs NCBI-ProteinID:  AWN23687 UniProt:  A0A2Z3JER4 LinkDB All DBs Position 2225808..2226038 Genome browser AA seq 76 aa AA seqDB search MDTYEQVKNVIVDKLGVEADKVTPEARFVEDLGADSLETVELIMGLEDQFGVTISDEAAE NIRTVQAAVDYISSQQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggatacttacgaacaagtcaagaatgtgatcgtggacaagctgggcgtcgaggccgat aaagtcacgcccgaggcccgcttcgtcgaggacctcggcgccgacagcctggaaaccgtc gagctgatcatgggtctggaagaccagttcggcgtgaccatcagtgacgaggccgccgag aacatccgcacggtgcaggccgccgtggactacatcagcagccagcagtaa

DBGET integrated database retrieval system